PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000392G1070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 127aa    MW: 14666.9 Da    PI: 10.4682
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000392G1070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.4e-1059932155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
                     + +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  PH01000392G1070 59 RWPYPTEEDKVRLAAMTGLNPKQINNWFINQRKRH 93
                     569*****************************985 PP

2ELK34.83.5e-121334122
              ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                     ELK++Ll+KYsg+L+ L++EF+
  PH01000392G1070 13 ELKEMLLKKYSGCLSRLRSEFL 34
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.4231333IPR005539ELK domain
SMARTSM011883.6E-61334IPR005539ELK domain
PfamPF037894.1E-91334IPR005539ELK domain
PROSITE profilePS5007112.6653396IPR001356Homeobox domain
SMARTSM003891.8E-1335100IPR001356Homeobox domain
SuperFamilySSF466892.22E-2035104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-273898IPR009057Homeodomain-like
CDDcd000869.58E-124597No hitNo description
PfamPF059205.8E-185392IPR008422Homeobox KN domain
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGQEHSSRLA DHELKEMLLK KYSGCLSRLR SEFLKKRKKG KLPKDARTAL LEWWNAHYRW  60
PYPTEEDKVR LAAMTGLNPK QINNWFINQR KRHWKPSEDM RFALMEGVAG GSSGTTLYFD  120
TGTIGP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12837LRSEFLKKRK
23438KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0076261e-116AB007626.1 Oryza sativa Japonica Group HOS16 mRNA, partial cds.
GenBankAK2413121e-116AK241312.1 Oryza sativa Japonica Group cDNA, clone: J065141L09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967561.19e-80PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ7GDL54e-77KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
SwissprotA2Y0074e-77KNOSA_ORYSI; Homeobox protein knotted-1-like 10
TrEMBLK3XMZ54e-80K3XMZ5_SETIT; Uncharacterized protein
TrEMBLC5XI601e-79C5XI60_SORBI; Putative uncharacterized protein Sb03g012480
STRINGSi003268m1e-79(Setaria italica)
STRINGSb03g012480.13e-79(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.13e-38KNOTTED-like from Arabidopsis thaliana